PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10020995
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family G2-like
Protein Properties Length: 398aa    MW: 43739.2 Da    PI: 7.8396
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10020995genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81.1e-32254309156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  Lus10020995 254 KQRRCWSPELHRRFVNALQQLGGSQAATPKQIREIMQVDGLTNDEVKSHLQKYRLH 309
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.17E-18252312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-29253313IPR009057Homeodomain-like
PROSITE profilePS5129412.287253311IPR017930Myb domain
TIGRFAMsTIGR015572.7E-27254309IPR006447Myb domain, plants
PfamPF002491.8E-7256307IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MSSVPAELSS NLFDFRTMMS SSSPSSKFVP IGDFLRTKMI GDAKAAEKTA RSSLPRAESL  60
LRELQEEMRR IDHAKIQLPL CMLLLNDTMM VVKESVKREK PLVLEEFIPL KKDEECKDDD  120
SLVQAEKDSC KDKKSWMSSV QLWSSDDTRQ EVNKKGNRCG NKDTFSASKN WTPVNLPIKN  180
VAKLSSTKEE SGREEDLAAP SLSLQTPGMK NLSEESGSTG SRITSSRGGI SSSAPNSQSS  240
SHKGPILPLQ PCRKQRRCWS PELHRRFVNA LQQLGGSQAA TPKQIREIMQ VDGLTNDEVK  300
SHLQKYRLHT RRMAPAGTAP GNQSLVVLGG LWMSQEQYAE SSKAASSQSG SPPGPLELGT  360
TLMEEDEDED DDKDDAKSDN HSWKSLTPRS ASGRAGV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072452.11e-114PREDICTED: probable transcription factor KAN3
TrEMBLA0A067L2E91e-114A0A067L2E9_JATCU; Uncharacterized protein
STRINGPOPTR_0009s10980.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-36G2-like family protein